MATLAB programming tips 2 - Input and Output Commands
Download as pptx, pdf4 likes1,783 views
This document provides an overview of several Matlab commands for input/output: 1) The input command prompts the user to enter a value and stores it in a variable. The sscanf command reads data as a string and converts it to other formats. 2) The disp command displays variable values or text without variable names. The fprintf command formats and displays data on screen or writes it to a file with control over formatting. 3) The fprintf command uses formatting operators like %d, %f, and %s to control the display of different data types when combined with conversion characters.
1 of 9
Downloaded 46 times
Ad
Recommended
Matlab Functions
Matlab FunctionsUmer Azeem This document discusses functions in MATLAB. It defines a function as a group of statements that perform a task and can accept inputs and produce outputs. Functions provide reusable code and can accept multiple input arguments and return multiple output arguments. There are built-in MATLAB functions and user-defined functions. Built-in functions include basic math, trigonometric, data analysis, and other functions. User-defined functions are created by the user and must have the same name as the file. They are defined using the function keyword and can return single or multiple outputs. Functions are called from the command window by specifying their name and valid inputs.
Python strings presentation
Python strings presentationVedaGayathri1 This document provides an overview of Python strings, including their definition, creation, and storage, as well as methods for slicing, modifying, concatenating, and formatting strings. It highlights key string functions such as upper(), lower(), strip(), and how to handle escape characters. The document serves as an informative guide for understanding and working with string data types in Python programming.
Procedure and Functions in pl/sql
Procedure and Functions in pl/sqlÑirmal Tatiwal This document discusses procedures and functions in PL/SQL. It defines a procedure as a group of PL/SQL statements that can be called by name and does not need to return a value. A function is similar to a procedure but must return a single value. The document provides the syntax for creating procedures and functions, and examples of standalone and recursive procedures and functions. It explains how to call procedures and functions, and the differences between them, such as procedures not having a return value while functions do.
How to use Map() Filter() and Reduce() functions in Python | Edureka
How to use Map() Filter() and Reduce() functions in Python | EdurekaEdureka! The document provides an introduction to three essential functions in Python: map(), filter(), and reduce(). The map() function applies a specified function to all elements in an iterable and returns a new list, filter() filters elements based on a condition, and reduce() accumulates values from an iterable into a single result. It also discusses how these functions can be combined to process data efficiently.
Python Pandas
Python PandasSunil OS Pandas is an open source Python library that provides data structures and data analysis tools for working with tabular data. It allows users to easily perform operations on different types of data such as tabular, time series, and matrix data. Pandas provides data structures like Series for 1D data and DataFrame for 2D data. It has tools for data cleaning, transformation, manipulation, and visualization of data.
Complexity analysis in Algorithms
Complexity analysis in AlgorithmsDaffodil International University 1) The document discusses complexity analysis of algorithms, which involves determining the time efficiency of algorithms by counting the number of basic operations performed based on input size.
2) It covers motivations for complexity analysis, machine independence, and analyzing best, average, and worst case complexities.
3) Simple rules are provided for determining the complexity of code structures like loops, nested loops, if/else statements, and switch cases based on the number of iterations and branching.
Python : Data Types
Python : Data TypesEmertxe Information Technologies Pvt Ltd The document provides an overview of data types in Python, including comments, numeric types, strings, bytes, bytearrays, lists, tuples, sets, frozensets, and dictionaries. It explains how to use these data types with examples and discusses their characteristics, such as mutability and conversion methods. Additionally, it touches upon determining variable types with the 'type()' function.
Introduction to c#
Introduction to c#OpenSource Technologies Pvt. Ltd. C# is a component-oriented programming language that builds on the .NET framework. It has a familiar C-like syntax that is easy for developers familiar with C, C++, Java, and Visual Basic to adopt. C# is fully object-oriented and optimized for building .NET applications. Everything in C# belongs to a class, with basic data types including integers, floats, booleans, characters, and strings. C# supports common programming constructs like variables, conditional statements, loops, methods, and classes. C# can be easily combined with ASP.NET for building web applications in a powerful, fast, and high-level way.
Matlab Script - Loop Control
Matlab Script - Loop ControlShameer Ahmed Koya This document covers loop control methods in MATLAB, specifically 'for' and 'while' loops. It explains their syntax, application, and how each loop type operates differently, emphasizing the importance of proper initialization and condition checks to avoid infinite loops. Additionally, it provides practical examples for both loop types to illustrate their usage in programming.
10. funtions and closures IN SWIFT PROGRAMMING
10. funtions and closures IN SWIFT PROGRAMMINGLOVELY PROFESSIONAL UNIVERSITY Functions allow code to be reused by defining blocks of code that can be executed multiple times. Functions take in parameters and may return values. Functions can be passed as arguments to other functions or returned from functions. Nested functions define functions inside other functions, limiting their scope. Closures are self-contained blocks of code that can be passed around like functions but are anonymous. Closures capture values from the context in which they are defined.
Mysql joins
Mysql joinsbaabtra.com - No. 1 supplier of quality freshers This document discusses different types of joins in MySQL, including inner joins, cross joins, left joins, right joins, and self joins. Inner joins return rows when there is a match between both tables based on the join condition. Cross joins return the Cartesian product of the two tables without a join condition. Left joins return all rows from the left table matched or not and return null values for rows that do not match in the right table. Right joins are similar but return all rows from the right table. Self joins allow a table to be joined with itself.
Algorithm Design Technique
Algorithm Design Technique Bharat Bhushan The document presents an overview of dynamic programming as an algorithm design technique, emphasizing its application in solving optimization problems through the breakdown into simpler sub-problems. It outlines both top-down and bottom-up approaches, detailing their methodology and differences, along with examples of problems solvable by dynamic programming. Additionally, the document discusses the advantages and disadvantages of the dynamic programming approach, highlighting aspects such as coding efficiency and memory considerations.
Destructors
DestructorsDeepikaT13 A destructor is a special member function that is called automatically when an object is destroyed or goes out of scope. It performs cleanup actions like freeing memory allocated to the object. Destructors are defined with a tilde symbol preceding the class name and they take no arguments and return no value. They are mainly used to delete dynamically allocated memory for an object and its members before the object is destroyed.
Python Datatypes by SujithKumar
Python Datatypes by SujithKumarSujith Kumar The document describes the differences between mutable and immutable objects in Python, categorizing data types into groups such as boolean, numeric, sequences, sets, and mappings. It elaborates on specific data types like integers, floats, lists, tuples, bytearrays, and dictionaries, detailing their properties, operations, and sample methods. Additionally, it explains how to manipulate these data types through operations like indexing, concatenation, and various built-in methods.
TYPES DATA STRUCTURES( LINEAR AND NON LINEAR)....
TYPES DATA STRUCTURES( LINEAR AND NON LINEAR)....Shail Nakum The presentation discusses data structures, focusing on the differences between linear and nonlinear types. Linear structures, like arrays, stacks, queues, and linked lists, organize data sequentially, making them easier to implement in memory. In contrast, nonlinear structures, such as trees and graphs, have complex relationships among elements, which can complicate their implementation.
Unit 1 introduction to visual basic programming
Unit 1 introduction to visual basic programmingAbha Damani This document provides an introduction to visual basic programming, covering topics such as variables, data types, operators, flow control, procedures, arrays, strings, and exception handling. It discusses the visual studio integrated development environment and its key components. It defines variables and data types, and covers implicit and explicit type conversions. Control flow structures like conditional statements, selection statements, and iteration statements are explained. Procedures such as subroutines and functions are defined. Finally, it provides examples of arrays and strings.
User defined functions in C
User defined functions in CHarendra Singh The document explains the concept of functions in programming, detailing their definition and categories, such as library and user-defined functions. It outlines the elements necessary for user-defined functions, including function declaration, call, and definition, along with various types of functions based on arguments and return values. Additionally, it provides syntax examples and usage scenarios for different functions to illustrate their application in programming.
Python GUI
Python GUILusciousLarryDas Tkinter is a standard GUI library for Python that provides a powerful object-oriented interface to the Tk GUI toolkit. It allows for the creation of GUI applications through widgets like buttons, labels, text boxes, and more. Tkinter applications start with importing the library and creating a main window with Tk(), then entering the main event loop with mainloop() to wait for and process events. Widgets can be organized and placed within the main window using geometry managers like pack(), grid(), and place(). Events can also be handled through binding Python functions to different widget events.
Python - Data Structures
Python - Data StructuresNR Computer Learning Center The document provides an overview of data structures in Python, including lists, tuples, sets, and dictionaries, detailing their properties, usage, and syntax. Dr. Vazi Okhandiar, an experienced computer science educator, offers insights into effective data organization for efficient programming. Additionally, the document features examples of creating, updating, and manipulating these data structures, as well as links for further practice and learning resources.
Map, Filter and Reduce In Python
Map, Filter and Reduce In PythonSimplilearn The document explains the functionality of three key Python functions: map(), filter(), and reduce(). The map() function applies a given function to each item in a sequence, the filter() function filters elements based on a condition, and the reduce() function condenses a sequence into a single value. Additionally, contact information for Simplilearn Solutions Pvt. Ltd. in India and the United States is provided.
Introduction to Python Pandas for Data Analytics
Introduction to Python Pandas for Data AnalyticsPhoenix This document provides an introduction to Python and its libraries specifically for data analytics, emphasizing Python's features, programming concepts, and tools like NumPy and Matplotlib. It covers the basics of Python programming, variable types, operators, data structures such as lists and dictionaries, as well as fundamental programming concepts like conditional statements and functions. The content is organized into sections, leading to a case study and conclusion while highlighting the performance benefits of using libraries like NumPy for numerical computations.
Chapter 6 algorithms and flow charts
Chapter 6 algorithms and flow chartsPraveen M Jigajinni This document provides information about algorithms and flowcharts. It begins with defining an algorithm as a sequence of steps to solve a problem and discusses properties like finiteness, definiteness, inputs, outputs, and effectiveness. Examples of algorithms are provided for tasks like making noodles and checking voter eligibility. Flowcharts are introduced as a way to visually represent algorithms using standard symbols like rectangles, diamonds, and arrows. Advantages of algorithms and flowcharts are that they improve problem solving, communication, and programming. The document concludes with flowchart examples and a short class test.
Built in function
Built in functionMD. Rayhanul Islam Sayket This presentation introduces built-in functions in C programming. It defines built-in functions as functions provided by the C library that perform common tasks like file access, math operations, and graphics without needing to be defined by the programmer. It provides examples of commonly used built-in functions from header files like stdio.h for input/output, string.h for string manipulation, and math.h for math functions. The presentation concludes by noting advantages like code reusability but also potential disadvantages like increased complexity from functions.
Strings in python
Strings in pythonPrabhakaran V M The document discusses strings in Python. It describes that strings are immutable sequences of characters that can contain letters, numbers and special characters. It covers built-in string functions like len(), max(), min() for getting the length, maximum and minimum character. It also discusses string slicing, concatenation, formatting, comparison and various string methods for operations like conversion, formatting, searching and stripping whitespace.
Hands on Session on Python
Hands on Session on PythonSumit Raj The document is a comprehensive guide on Python programming, covering its history, syntax, data types, control flow, and standard library functionalities. It addresses the language's high-level, object-oriented nature, its wide application in various industries, and its ease of use for rapid development. Additionally, it includes practical coding exercises and resources for further learning.
Exception handling c++
Exception handling c++Jayant Dalvi This document discusses exception handling in C++. It defines an exception as an event that occurs during program execution that disrupts normal flow, like divide by zero errors. Exception handling allows the program to maintain normal flow even after errors by catching and handling exceptions. It describes the key parts of exception handling as finding problems, throwing exceptions, catching exceptions, and handling exceptions. The document provides examples of using try, catch, and throw blocks to handle exceptions in C++ code.
List in Python
List in PythonSharath Ankrajegowda Lists in Python allow storing and manipulating multiple items in a single variable. They can contain elements of different data types like strings, integers, and booleans. Lists can be accessed using indexes, sorted, copied, and joined. Common list methods include append(), insert(), remove(), pop(), sort(), and reverse() to add, remove, and rearrange list elements.
Database connectivity in python
Database connectivity in pythonbaabtra.com - No. 1 supplier of quality freshers This document discusses connecting Python to databases. It outlines 4 steps: 1) importing database modules, 2) establishing a connection, 3) creating a cursor object, and 4) executing SQL queries. It provides code examples for connecting to MySQL and PostgreSQL databases, creating a cursor, and fetching data using methods like fetchall(), fetchmany(), and fetchone(). The document is an introduction to connecting Python applications to various database servers.
Conditional Control in MATLAB Scripts
Conditional Control in MATLAB ScriptsShameer Ahmed Koya The document provides an overview of conditional control and loop control in MATLAB, detailing the use of statements like if, elseif, and else to determine code execution based on conditions. It includes examples of conditional statements for evaluating height, calculating discounts, checking voltage signals, and comparing two input values. Additionally, the document explains how to assign grades based on input marks.
Anonymous and Inline Functions in MATLAB
Anonymous and Inline Functions in MATLABShameer Ahmed Koya The document discusses MATLAB's anonymous functions, which allow users to define functions without creating separate files, useful for simple expressions. It explains how to create an anonymous function using the '@' symbol, and highlights that these functions can only return a single variable and must consist of one expression. Additionally, it addresses the similarity to inline functions and provides examples of function creation and execution.
More Related Content
What's hot (20)
Matlab Script - Loop Control
Matlab Script - Loop ControlShameer Ahmed Koya This document covers loop control methods in MATLAB, specifically 'for' and 'while' loops. It explains their syntax, application, and how each loop type operates differently, emphasizing the importance of proper initialization and condition checks to avoid infinite loops. Additionally, it provides practical examples for both loop types to illustrate their usage in programming.
10. funtions and closures IN SWIFT PROGRAMMING
10. funtions and closures IN SWIFT PROGRAMMINGLOVELY PROFESSIONAL UNIVERSITY Functions allow code to be reused by defining blocks of code that can be executed multiple times. Functions take in parameters and may return values. Functions can be passed as arguments to other functions or returned from functions. Nested functions define functions inside other functions, limiting their scope. Closures are self-contained blocks of code that can be passed around like functions but are anonymous. Closures capture values from the context in which they are defined.
Mysql joins
Mysql joinsbaabtra.com - No. 1 supplier of quality freshers This document discusses different types of joins in MySQL, including inner joins, cross joins, left joins, right joins, and self joins. Inner joins return rows when there is a match between both tables based on the join condition. Cross joins return the Cartesian product of the two tables without a join condition. Left joins return all rows from the left table matched or not and return null values for rows that do not match in the right table. Right joins are similar but return all rows from the right table. Self joins allow a table to be joined with itself.
Algorithm Design Technique
Algorithm Design Technique Bharat Bhushan The document presents an overview of dynamic programming as an algorithm design technique, emphasizing its application in solving optimization problems through the breakdown into simpler sub-problems. It outlines both top-down and bottom-up approaches, detailing their methodology and differences, along with examples of problems solvable by dynamic programming. Additionally, the document discusses the advantages and disadvantages of the dynamic programming approach, highlighting aspects such as coding efficiency and memory considerations.
Destructors
DestructorsDeepikaT13 A destructor is a special member function that is called automatically when an object is destroyed or goes out of scope. It performs cleanup actions like freeing memory allocated to the object. Destructors are defined with a tilde symbol preceding the class name and they take no arguments and return no value. They are mainly used to delete dynamically allocated memory for an object and its members before the object is destroyed.
Python Datatypes by SujithKumar
Python Datatypes by SujithKumarSujith Kumar The document describes the differences between mutable and immutable objects in Python, categorizing data types into groups such as boolean, numeric, sequences, sets, and mappings. It elaborates on specific data types like integers, floats, lists, tuples, bytearrays, and dictionaries, detailing their properties, operations, and sample methods. Additionally, it explains how to manipulate these data types through operations like indexing, concatenation, and various built-in methods.
TYPES DATA STRUCTURES( LINEAR AND NON LINEAR)....
TYPES DATA STRUCTURES( LINEAR AND NON LINEAR)....Shail Nakum The presentation discusses data structures, focusing on the differences between linear and nonlinear types. Linear structures, like arrays, stacks, queues, and linked lists, organize data sequentially, making them easier to implement in memory. In contrast, nonlinear structures, such as trees and graphs, have complex relationships among elements, which can complicate their implementation.
Unit 1 introduction to visual basic programming
Unit 1 introduction to visual basic programmingAbha Damani This document provides an introduction to visual basic programming, covering topics such as variables, data types, operators, flow control, procedures, arrays, strings, and exception handling. It discusses the visual studio integrated development environment and its key components. It defines variables and data types, and covers implicit and explicit type conversions. Control flow structures like conditional statements, selection statements, and iteration statements are explained. Procedures such as subroutines and functions are defined. Finally, it provides examples of arrays and strings.
User defined functions in C
User defined functions in CHarendra Singh The document explains the concept of functions in programming, detailing their definition and categories, such as library and user-defined functions. It outlines the elements necessary for user-defined functions, including function declaration, call, and definition, along with various types of functions based on arguments and return values. Additionally, it provides syntax examples and usage scenarios for different functions to illustrate their application in programming.
Python GUI
Python GUILusciousLarryDas Tkinter is a standard GUI library for Python that provides a powerful object-oriented interface to the Tk GUI toolkit. It allows for the creation of GUI applications through widgets like buttons, labels, text boxes, and more. Tkinter applications start with importing the library and creating a main window with Tk(), then entering the main event loop with mainloop() to wait for and process events. Widgets can be organized and placed within the main window using geometry managers like pack(), grid(), and place(). Events can also be handled through binding Python functions to different widget events.
Python - Data Structures
Python - Data StructuresNR Computer Learning Center The document provides an overview of data structures in Python, including lists, tuples, sets, and dictionaries, detailing their properties, usage, and syntax. Dr. Vazi Okhandiar, an experienced computer science educator, offers insights into effective data organization for efficient programming. Additionally, the document features examples of creating, updating, and manipulating these data structures, as well as links for further practice and learning resources.
Map, Filter and Reduce In Python
Map, Filter and Reduce In PythonSimplilearn The document explains the functionality of three key Python functions: map(), filter(), and reduce(). The map() function applies a given function to each item in a sequence, the filter() function filters elements based on a condition, and the reduce() function condenses a sequence into a single value. Additionally, contact information for Simplilearn Solutions Pvt. Ltd. in India and the United States is provided.
Introduction to Python Pandas for Data Analytics
Introduction to Python Pandas for Data AnalyticsPhoenix This document provides an introduction to Python and its libraries specifically for data analytics, emphasizing Python's features, programming concepts, and tools like NumPy and Matplotlib. It covers the basics of Python programming, variable types, operators, data structures such as lists and dictionaries, as well as fundamental programming concepts like conditional statements and functions. The content is organized into sections, leading to a case study and conclusion while highlighting the performance benefits of using libraries like NumPy for numerical computations.
Chapter 6 algorithms and flow charts
Chapter 6 algorithms and flow chartsPraveen M Jigajinni This document provides information about algorithms and flowcharts. It begins with defining an algorithm as a sequence of steps to solve a problem and discusses properties like finiteness, definiteness, inputs, outputs, and effectiveness. Examples of algorithms are provided for tasks like making noodles and checking voter eligibility. Flowcharts are introduced as a way to visually represent algorithms using standard symbols like rectangles, diamonds, and arrows. Advantages of algorithms and flowcharts are that they improve problem solving, communication, and programming. The document concludes with flowchart examples and a short class test.
Built in function
Built in functionMD. Rayhanul Islam Sayket This presentation introduces built-in functions in C programming. It defines built-in functions as functions provided by the C library that perform common tasks like file access, math operations, and graphics without needing to be defined by the programmer. It provides examples of commonly used built-in functions from header files like stdio.h for input/output, string.h for string manipulation, and math.h for math functions. The presentation concludes by noting advantages like code reusability but also potential disadvantages like increased complexity from functions.
Strings in python
Strings in pythonPrabhakaran V M The document discusses strings in Python. It describes that strings are immutable sequences of characters that can contain letters, numbers and special characters. It covers built-in string functions like len(), max(), min() for getting the length, maximum and minimum character. It also discusses string slicing, concatenation, formatting, comparison and various string methods for operations like conversion, formatting, searching and stripping whitespace.
Hands on Session on Python
Hands on Session on PythonSumit Raj The document is a comprehensive guide on Python programming, covering its history, syntax, data types, control flow, and standard library functionalities. It addresses the language's high-level, object-oriented nature, its wide application in various industries, and its ease of use for rapid development. Additionally, it includes practical coding exercises and resources for further learning.
Exception handling c++
Exception handling c++Jayant Dalvi This document discusses exception handling in C++. It defines an exception as an event that occurs during program execution that disrupts normal flow, like divide by zero errors. Exception handling allows the program to maintain normal flow even after errors by catching and handling exceptions. It describes the key parts of exception handling as finding problems, throwing exceptions, catching exceptions, and handling exceptions. The document provides examples of using try, catch, and throw blocks to handle exceptions in C++ code.
List in Python
List in PythonSharath Ankrajegowda Lists in Python allow storing and manipulating multiple items in a single variable. They can contain elements of different data types like strings, integers, and booleans. Lists can be accessed using indexes, sorted, copied, and joined. Common list methods include append(), insert(), remove(), pop(), sort(), and reverse() to add, remove, and rearrange list elements.
Database connectivity in python
Database connectivity in pythonbaabtra.com - No. 1 supplier of quality freshers This document discusses connecting Python to databases. It outlines 4 steps: 1) importing database modules, 2) establishing a connection, 3) creating a cursor object, and 4) executing SQL queries. It provides code examples for connecting to MySQL and PostgreSQL databases, creating a cursor, and fetching data using methods like fetchall(), fetchmany(), and fetchone(). The document is an introduction to connecting Python applications to various database servers.
Viewers also liked (6)
Conditional Control in MATLAB Scripts
Conditional Control in MATLAB ScriptsShameer Ahmed Koya The document provides an overview of conditional control and loop control in MATLAB, detailing the use of statements like if, elseif, and else to determine code execution based on conditions. It includes examples of conditional statements for evaluating height, calculating discounts, checking voltage signals, and comparing two input values. Additionally, the document explains how to assign grades based on input marks.
Anonymous and Inline Functions in MATLAB
Anonymous and Inline Functions in MATLABShameer Ahmed Koya The document discusses MATLAB's anonymous functions, which allow users to define functions without creating separate files, useful for simple expressions. It explains how to create an anonymous function using the '@' symbol, and highlights that these functions can only return a single variable and must consist of one expression. Additionally, it addresses the similarity to inline functions and provides examples of function creation and execution.
MATLAB Scripts - Examples
MATLAB Scripts - ExamplesShameer Ahmed Koya The document presents MATLAB sample scripts focusing on electrical engineering applications. It includes programs for calculating building height, BMI, electricity bills, and analyzing circuit characteristics. Various applications such as RLC circuit current vs frequency plots and synchronous motor voltage calculations are also discussed.
User defined Functions in MATLAB Part 1
User defined Functions in MATLAB Part 1Shameer Ahmed Koya User-defined functions in MATLAB allow users to create reusable code that can accept inputs and produce outputs. Functions are defined with specific syntax and can include multiple input and output arguments, with local variables that are only accessible within the function. Proper naming conventions and organization of function files are essential for clarity and effectiveness.
User Defined Functions in MATLAB Part-4
User Defined Functions in MATLAB Part-4Shameer Ahmed Koya The document explains the concept of function handles in MATLAB, which are data types that store associations with functions, allowing indirect calls to both built-in and user-defined functions. It discusses various uses, such as passing functions to other functions, callback functions in GUI programming, and creating anonymous functions. Additionally, it covers local and private functions, emphasizing their visibility and scope within the code structure.
Matlab Introduction
Matlab IntroductionDaniel Moore This document introduces MATLAB, a computing environment and programming language optimized for numerical and image analysis, with a focus on matrix and vector algebra. It covers the benefits of using MATLAB, including extensive libraries, fast processing, and advanced visualizations, along with basic programming concepts like m-files and data import methods. Additionally, it outlines graphing capabilities, data fitting, and provides resources for further learning.
Ad
Similar to MATLAB programming tips 2 - Input and Output Commands (20)
Introduction to matlab
Introduction to matlabMohan Raj MATLAB is a matrix-based programming language used for numerical computations, data analysis, and visualization. It allows matrix manipulations, functions for computation and visualization, toolboxes for different applications, and integrated development environment for programming. MATLAB can be used for engineering and scientific calculations with graphical output. It has built-in functions, user-defined functions, 2D and 3D graphics capabilities, GUI tools, and interfaces with other languages like C and Fortran.
Python variables in the computer science.pptx
Python variables in the computer science.pptxRajasekhar364622 The document explains input-output statements in Python, particularly focusing on the built-in functions for standard input and output, such as input() and print(). It details how to use the print() function to display data, including formatting options using str.format() and the old sprintf() style. Additionally, it introduces the input() function for taking user input in a Python program.
POEPPSGNHwkejnkweoewnkenjwjewkjewoewkjewijewjk
POEPPSGNHwkejnkweoewnkenjwjewkjewoewkjewijewjkhanumanthumanideeph6 This document provides an extensive overview of string basics and functions in C programming, detailing string declaration, initialization, and various string manipulation functions such as gets(), puts(), strcat(), and strcmp(). It also covers function prototypes, definitions, parameters, and the difference between call by value and call by reference. The document serves as a comprehensive guide for understanding string handling and function usage in C.
Functions of stdio conio
Functions of stdio conio Bhavik Vashi This document discusses functions in the stdio.h and conio.h header files in C programming. It describes common input/output functions like printf(), scanf(), gets(), puts(), getchar(), and putchar() that are used for basic input from and output to the console. It also covers functions specific to conio.h like clrscr() and getch() that are used to clear the screen and get a character from the keyboard without echoing it.
miniLesson on the printf() function
miniLesson on the printf() functionChristine Wolfe This presentation includes custom animations that require viewing the presentation in Slide Show mode and allowing activeX controls. To view the animations, open the presentation in PowerPoint and use the menus to enter Slide Show mode. A notice may appear warning that activeX or other scripts are disabled - these controls must be enabled to see the animations.
To be able to add user input to m-files To be able to control the output fro...
To be able to add user input to m-files To be able to control the output fro...AliALKHAYYAT8 Simplest way of output is to leave “;” from end of line.
The next output command is “disp”, which can be used to display text or the value of a variable without displaying the variable name
8. MATLAB can generate random numbers using the rand command. rand on its own...
8. MATLAB can generate random numbers using the rand command. rand on its own...AliALKHAYYAT8 8. MATLAB can generate random numbers using the rand command. rand on its own generates a scalar number (i.e. a single number). rand(1,5) would generate 5 random numbers
MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdf
MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdfSowmyaJyothi3 The document discusses input and output operations in C programming, specifically using functions such as scanf and printf for data entry and display. It explains how to read and write characters, handle different data types, utilize formatted input/output, and the significance of format specifications. Additionally, it covers character test functions and mixed data input/output scenarios.
Beginning with vi text editor
Beginning with vi text editorJose Pla vi is a text editor that allows users to:
1. Open, edit, and save text files from within the program using various commands like :w to write/save and :q to quit.
2. Navigate text using cursor keys, search with /pattern, and move between lines and screens using G, ctrl+D/U, and ctrl+B/F.
3. Insert, delete, change, and replace text using commands like i, a, dd, cw, s, and ~.
4. Cut/copy text to buffers using d and yank commands like yw and paste using p, search and replace with :s, and join lines with J.
1. Ch_1 SL_1_Intro to Matlab.pptx
1. Ch_1 SL_1_Intro to Matlab.pptxMOHAMMAD SAYDUL ALAM Here is a MATLAB script to solve the quadratic equation with variable coefficients:
% Script to solve the quadratic equation ax^2 + bx + c = 0
clear
disp('Enter coefficients a, b, c: ')
a = input('a = ');
b = input('b = ');
c = input('c = ');
x = sym('x');
sol = solve(a*x^2 + b*x + c == 0, x);
disp('The solutions are:')
disp(sol)
This script first clears any existing variables, then prompts the user to input the coefficients a, b, and c. It then defines x as a symbolic variable
Lecture 8- Data Input and Output
Lecture 8- Data Input and OutputMd. Imran Hossain Showrov The document discusses input/output functions in C programming, focusing on character input and output using getchar and putchar, as well as data input using scanf and output using printf. It provides examples of how to use these functions to read and display characters and formatted data. Additionally, it highlights control strings and field widths in the printf function to format output effectively.
Diploma ii cfpc u-4 function, storage class and array and strings
Diploma ii cfpc u-4 function, storage class and array and stringsRai University The document discusses various aspects of arrays and functions in C programming language. It explains that arrays allow storing multiple elements of the same type using a single name. One-dimensional and multi-dimensional arrays are described along with initialization and accessing of array elements. Common string handling functions like strcat(), strcmp(), strcpy() are also summarized. The document also provides the general forms of defining and calling functions in C and different categories of functions based on arguments and return values.
Introduction to Input/Output Functions in C
Introduction to Input/Output Functions in CThesis Scientist Private Limited The document provides an overview of input/output functions in the C programming language, specifically through the standard library stdio.h. It categorizes I/O functions into console, disk, and port types, with a focus on formatted and unformatted console I/O functions. The text explains the use of scanf() and printf() for data input and output, detailing format specifications for various data types.
Lecture-2.pptxefygefyeyyegfygcyewvwvvcvywcy
Lecture-2.pptxefygefyeyyegfygcyewvwvvcvywcyhamzah7958 The document outlines the basics of C programming, focusing on input and output functions such as printf() and scanf(). It describes the structure of a C program, including preprocessor commands, functions, and comments, along with examples of how to use the printf() and scanf() functions. Additionally, it provides instructions for compiling and executing a C program using a text editor.
Each n Every topic of C Programming.pptx
Each n Every topic of C Programming.pptxsnnbarot C is a general-purpose programming language developed in 1972, known for its speed and foundational role in computer science, particularly associated with Unix systems. Key features of C include its syntax for statements, data types, variables, operators, and control structures like loops and conditional statements, which aid in building various applications. Additionally, C's use of header files and functions for input/output operations allows for structured and efficient coding practices.
Mcai pic u 4 function, storage class and array and strings
Mcai pic u 4 function, storage class and array and stringsRai University Arrays allow storing multiple values of the same type under a common name. One-dimensional arrays use a single subscript to access elements, while multi-dimensional arrays use multiple subscripts. Strings are arrays of characters that end with a null character. Functions allow breaking programs into smaller, reusable parts. Functions can take arguments, return values, or do both. Variables declared inside functions have automatic storage, while those outside have external storage. Arrays and strings can be passed to functions. Recursion occurs when a function calls itself.
Input And Output
Input And OutputGhaffar Khan The document discusses input and output functions in C programming. It describes getchar() and putchar() for character input/output, printf() and scanf() for formatted input/output, and gets() and puts() for string input/output. It provides examples of using these functions to read input from the keyboard and display output to the screen.
Btech i pic u-4 function, storage class and array and strings
Btech i pic u-4 function, storage class and array and stringsRai University Arrays allow storing multiple values of the same type under a common name. One-dimensional arrays use a single subscript to access elements, while multi-dimensional arrays use multiple subscripts. Strings are arrays of characters terminated by a null character. Functions allow breaking programs into modular reusable units. Functions can take arguments, return values, or do both. Variables declared inside functions have automatic storage, while those outside have external storage. Arrays and strings can be passed to functions. Recursion occurs when a function calls itself.
Functions torage class and array and strings-
Functions torage class and array and strings-aneebkmct Arrays allow storing multiple values of the same type under a common name. One-dimensional arrays use a single subscript to access elements, while multi-dimensional arrays use multiple subscripts. Strings are arrays of characters terminated by a null character. Functions allow breaking programs into smaller, reusable parts. Functions can accept arguments, return values, or have no arguments and return nothing. Variables declared inside functions have automatic storage, while those outside have external storage.
function, storage class and array and strings
function, storage class and array and stringsRai University The document discusses one-dimensional arrays in C programming. It defines arrays, explains how to declare and initialize them, and provides examples of accessing array elements. It also discusses reading and printing arrays, and summarizes common string handling functions in C like strcat(), strcmp(), and strcpy().
Ad
More from Shameer Ahmed Koya (7)
User Defined Functions in MATLAB part 2
User Defined Functions in MATLAB part 2Shameer Ahmed Koya The document discusses user-defined functions in MATLAB, covering various types such as those with inputs and outputs, functions with no inputs or outputs, and functions that return multiple outputs. Examples provided include basic mathematical operations, calculating averages, and determining distances between points. The document also explains how to call these functions from the command window or within scripts.
MATLAB Programming - Loop Control Part 2
MATLAB Programming - Loop Control Part 2Shameer Ahmed Koya The document discusses loop control in programming, covering switch-case commands, nested loops, break, and continue commands. It explains the syntax and usage of each command with examples, illustrating how they function within loops. The tutorial aims to provide foundational knowledge for handling loops and conditions effectively in programming.
Introduction to Matlab Scripts
Introduction to Matlab ScriptsShameer Ahmed Koya The document provides guidance on using MATLAB scripts, emphasizing their creation and execution through text files with a '.m' extension. It explains how to write, save, and run scripts, as well as common errors related to script execution and variable management in the MATLAB workspace. Key issues include ensuring the script file is in the internal MATLAB path and understanding that script variables are global and may be modified by other scripts.
Matlab Programming Tips Part 1
Matlab Programming Tips Part 1Shameer Ahmed Koya The document provides an introduction to MATLAB programming, detailing how to use scripts and function files for executing commands. It explains the structure of script files and function files, highlighting the differences between them, and emphasizes the importance of coding best practices such as commenting and variable naming conventions. Additionally, examples and programming styles are outlined to aid users in writing effective and organized MATLAB programs.
Polynomials and Curve Fitting in MATLAB
Polynomials and Curve Fitting in MATLABShameer Ahmed Koya This document discusses various polynomial functions in MATLAB. It covers defining and manipulating polynomials, including evaluation, finding roots, addition/subtraction, multiplication/division, derivatives, and curve fitting using polynomial regression. Polynomials in MATLAB are defined as row vectors of coefficients. Key functions include polyval for evaluation, roots for finding roots, conv for multiplication, deconv for division, and polyfit for curve fitting.
MATLAB - Aplication of Arrays and Matrices in Electrical Systems
MATLAB - Aplication of Arrays and Matrices in Electrical SystemsShameer Ahmed Koya This document discusses using matrices and linear algebra to analyze electrical systems. It explains how to represent sets of linear equations in matrix form as A*x=y and solve for x using the inverse of A. It also discusses calculating the rank of a matrix and condition number. Examples are given of using matrices to solve circuit problems involving node analysis, mesh analysis, and AC circuits. Solutions are found by taking the inverse of the matrix or using the backslash operator in MATLAB.
MATLAB - Arrays and Matrices
MATLAB - Arrays and MatricesShameer Ahmed Koya The document covers the basics of arrays and matrices in MATLAB, explaining their structures, how to create and manipulate them, and the functions associated with them. It includes detailed examples of creating vectors and matrices, addressing elements, and performing mathematical operations such as addition, multiplication, and division. Moreover, it discusses built-in functions for generating matrices like zeros, ones, and random numbers, as well as approaches for appending and manipulating data in arrays.
Recently uploaded (20)
K12 Tableau User Group virtual event June 18, 2025
K12 Tableau User Group virtual event June 18, 2025dogden2 National K12 Tableau User Group: June 2025 meeting slides
A Visual Introduction to the Prophet Jeremiah
A Visual Introduction to the Prophet JeremiahSteve Thomason These images will give you a visual guide to both the context and the flow of the story of the prophet Jeremiah. Feel free to use these in your study, preaching, and teaching.
2025 June Year 9 Presentation: Subject selection.pptx
2025 June Year 9 Presentation: Subject selection.pptxmansk2 2025 June Year 9 Presentation: Subject selection
Filipino 9 Maikling Kwento Ang Ama Panitikang Asiyano
Filipino 9 Maikling Kwento Ang Ama Panitikang Asiyanosumadsadjelly121997 Filipino 9 Maikling Kwento Ang Ama Panitikang Asiyano
Vitamin and Nutritional Deficiencies.pptx
Vitamin and Nutritional Deficiencies.pptxVishal Chanalia Vitamin and nutritional deficiency occurs when the body does not receive enough essential nutrients, such as vitamins and minerals, needed for proper functioning. This can lead to various health problems, including weakened immunity, stunted growth, fatigue, poor wound healing, cognitive issues, and increased susceptibility to infections and diseases. Long-term deficiencies can cause serious and sometimes irreversible health complications.
How to use search fetch method in Odoo 18
How to use search fetch method in Odoo 18Celine George The search_fetch is a powerful ORM method used in Odoo for some specific addons to combine the functionality of search and read for more efficient data fetching. It might be used to search for records and fetch specific fields in a single call. It stores the result in the cache memory.
Paper 106 | Ambition and Corruption: A Comparative Analysis of ‘The Great Gat...
Paper 106 | Ambition and Corruption: A Comparative Analysis of ‘The Great Gat...Rajdeep Bavaliya Dive into the glittering allure and hidden rot of the American Dream as we compare Jay Gatsby’s lofty ambitions with Jordan Belfort’s brazen excess. Uncover how both characters chase success at the cost of their integrity and ultimately pay the price for unchecked desire. Which downfall resonates more—Gatsby’s doomed romance or Belfort’s scandalous spiral? Hit like if you’ve ever chased a dream, and follow for more literary-versus-film showdowns!
M.A. Sem - 2 | Presentation
Presentation Season - 2
Paper - 106: The Twentieth Century Literature: 1900 to World War II
Submitted Date: April 3, 2025
Paper Name: The Twentieth Century Literature: 1900 to World War II
Topic: Ambition and Corruption: A Comparative Analysis of ‘The Great Gatsby’ and ‘The Wolf of Wall Street’
[Please copy the link and paste it into any web browser to access the content.]
Video Link: https://youtu.be/4mXmSVjTLt8
For a more in-depth discussion of this presentation, please visit the full blog post at the following link: https://rajdeepbavaliya2.blogspot.com/2025/04/ambition-and-corruption-a-comparative-analysis-of-the-great-gatsby-and-the-wolf-of-wall-street.html
Please visit this blog to explore additional presentations from this season:
Hashtags:
#AmericanDream #GreatGatsby #WolfOfWallStreet #AmbitionAndCorruption #LiteratureVsFilm #Fitzgerald #Scorsese #JayGatsby #JordanBelfort #DreamOrDownfall
Keyword Tags:
The Great Gatsby, Wolf of Wall Street, American Dream analysis, ambition corruption, Gatsby vs. Belfort, F. Scott Fitzgerald themes, Martin Scorsese film, literary comparison, movie vs. novel, moral critique
Q1_ENGLISH_PPT_WEEK 1 power point grade 3 Quarter 1 week 1
Q1_ENGLISH_PPT_WEEK 1 power point grade 3 Quarter 1 week 1jutaydeonne Grade 3 Quarter 1 Week 1 English part 2
SCHIZOPHRENIA OTHER PSYCHOTIC DISORDER LIKE Persistent delusion/Capgras syndr...
SCHIZOPHRENIA OTHER PSYCHOTIC DISORDER LIKE Persistent delusion/Capgras syndr...parmarjuli1412 SCHIZOPHRENIA INCLUDED TOPIC IS INTRODUCTION, DEFINITION OF GENERAL TERM IN PSYCHIATRIC, THEN DIFINITION OF SCHIZOPHRENIA, EPIDERMIOLOGY, ETIOLOGICAL FACTORS, CLINICAL FEATURE(SIGN AND SYMPTOMS OF SCHIZOPHRENIA), CLINICAL TYPES OF SCHIZOPHRENIA, DIAGNOSIS, INVESTIGATION, TREATMENT MODALITIES(PHARMACOLOGICAL MANAGEMENT, PSYCHOTHERAPY, ECT, PSYCHO-SOCIO-REHABILITATION), NURSING MANAGEMENT(ASSESSMENT,DIAGNOSIS,NURSING INTERVENTION,AND EVALUATION), OTHER PSYCHOTIC DISORDER LIKE Persistent delusion/Capgras syndrome(The Delusion of Doubles)/Acute and Transient Psychotic Disorders/Induced Delusional Disorders/Schizoaffective Disorder /CAPGRAS SYNDROME(DELUSION OF DOUBLE), GERIATRIC CONSIDERATION, FOLLOW UP, HOMECARE AND REHABILITATION OF THE PATIENT,
Public Health For The 21st Century 1st Edition Judy Orme Jane Powell
Public Health For The 21st Century 1st Edition Judy Orme Jane Powelltrjnesjnqg7801 Public Health For The 21st Century 1st Edition Judy Orme Jane Powell
Public Health For The 21st Century 1st Edition Judy Orme Jane Powell
Public Health For The 21st Century 1st Edition Judy Orme Jane Powell
M&A5 Q1 1 differentiate evolving early Philippine conventional and contempora...
M&A5 Q1 1 differentiate evolving early Philippine conventional and contempora...ErlizaRosete MAPEH 6 QI WEEK I
HistoPathology Ppt. Arshita Gupta for Diploma
HistoPathology Ppt. Arshita Gupta for Diplomaarshitagupta674 Hello everyone please suggest your views and likes so that I uploaded more study materials
In this slide full HistoPathology according to diploma course available like fixation
Tissue processing , staining etc
YSPH VMOC Special Report - Measles Outbreak Southwest US 6-14-2025.pptx
YSPH VMOC Special Report - Measles Outbreak Southwest US 6-14-2025.pptxYale School of Public Health - The Virtual Medical Operations Center (VMOC) BLUF:
The Texas outbreak has slowed down, but sporadic cases continue to emerge in Kansas, Oklahoma, and New Mexico.
Elsewhere in the US, we continue to see signs of acceleration due to outbreaks outside the Southwest (North Dakota, Montana, and Colorado) and travel-related cases. Measles exposures due to travel are expected to pose a significant challenge throughout the summer.
The U.S. is on track to exceed its 30-year high for measles cases (1,274) within the next two weeks.
Here is the latest update:
CURRENT CASE COUNT: 919
•Texas: 744 (+2) (55% of cases are in Gaines County).
•New Mexico: 81 (83% of cases are from Lea County).
•Oklahoma: 20 (+2)
•Kansas: 74 (+5) (38.89% of the cases are from Gray County).
HOSPITALIZATIONS: 104
• Texas: 96 (+2) – This accounts for 13% of all cases in Texas.
• New Mexico: 7 – This accounts for 9.47% of all cases in New Mexico.
• Kansas: 3 – This accounts for 5.08% of all cases in the state of Kansas.
DEATHS: 3
•Texas: 2 – This is 0.27% of all cases in Texas.
•New Mexico: 1 – This is 1.23% of all cases in New Mexico.
US NATIONAL CASE COUNT: 1,197
INTERNATIONAL SPREAD
•Mexico: 2337 (+257), 5 fatalities
‒Chihuahua, Mexico: 2,179 (+239) cases, 4 fatalities, 7 currently hospitalized.
•Canada: 3,207 (+208), 1 fatality
‒Ontario Outbreak, Canada: 2,115 (+74) cases, 158 hospitalizations, 1 fatality.
‒Alberta, Canada: 879(+118) cases, 5 currently hospitalized.
Great Governors' Send-Off Quiz 2025 Prelims IIT KGP
Great Governors' Send-Off Quiz 2025 Prelims IIT KGPIIT Kharagpur Quiz Club Prelims of the Great Governors' Send-Off Quiz 2025 hosted by the outgoing governors.
QMs: Aarushi, Aatir, Aditya, Arnav
INDUCTIVE EFFECT slide for first prof pharamacy students
INDUCTIVE EFFECT slide for first prof pharamacy studentsSHABNAM FAIZ The inductive effect is the electron-withdrawing or electron-donating effect transmitted through sigma (σ) bonds in a molecule due to differences in electronegativity between atoms.
---
🔹 Definition:
The inductive effect is the permanent shifting of electrons in a sigma bond caused by the electronegativity difference of atoms, resulting in partial charges within the molecule.
Photo chemistry Power Point Presentation
Photo chemistry Power Point Presentationmprpgcwa2024 Photochemistry is the branch of chemistry that deals with the study of chemical reactions and processes initiated by light.
Photochemistry involves the interaction of light with molecules, leading to electronic excitation. Energy from light is transferred to molecules, initiating chemical reactions.
Photochemistry is used in solar cells to convert light into electrical energy.
It is used Light-driven chemical reactions for environmental remediation and synthesis. Photocatalysis helps in pollution abatement and environmental cleanup. Photodynamic therapy offers a targeted approach to treating diseases It is used in Light-activated treatment for cancer and other diseases.
Photochemistry is used to synthesize complex organic molecules.
Photochemistry contributes to the development of sustainable energy solutions.
YSPH VMOC Special Report - Measles Outbreak Southwest US 6-14-2025.pptx
YSPH VMOC Special Report - Measles Outbreak Southwest US 6-14-2025.pptxYale School of Public Health - The Virtual Medical Operations Center (VMOC)
MATLAB programming tips 2 - Input and Output Commands
- 1. 11 Matlab Programming Tips Part 2– Input / Output Commands (Review) by Shameer Koya
- 2. input Command input - Prompt for user input. Input is the simple basic command to request the user input. Displays a prompt text for the user to understand what data to be entered and waits for the user to input a value and press the Return key. i = input('Enter the current value:') str = input(‘text’,'s') returns the entered text as a MATLAB string, without evaluating expressions. 2
- 3. sscanf Command Read data as string and convert to the other formats based on the definition. X = sscanf(str, format, size) Reads data from the vector str, converts it according to the format, and store the results in array X. Argument ‘size’ is optional. 3
- 4. disp Command disp - (display) command displays variable values or text on screen Displays each time on new line. Doesn't print variable name disp(variable_name) or disp('text string') 4
- 5. fprintf Command fprintf - Means file print formatted 'fprintf' is used to formats data and displays the results on the screen and to write the data in to a text file. Can write to screen or to a file Can mix numbers and text in output Have full control of output display Basic Syntax is fprintf('Text to display') 5
- 6. >> fprintf( 'How are you' ) How are you>> Problem – Command Window displays prompt (>>) at end of text, not at start of next line! To make the prompt to appear on the start of a new line, n at the end of the fprintf text >> fprintf( Electrical Engineeringn' ) Electrical Engineering >> Use n in middle of text to make MATLAB display remainder of text on next line >> fprintf(' Electrical nEngineering') Electrical Engineering 6 fprintf …
- 7. To format the display data, the formatting operators are used. A formatting operator starts with a percentage sign, %, and ends with a conversion character. Common conversion specifiers: %f fixed point (decimal always between 1's and 0.1's place, e.g., 3.14, 56.8 %e scientific notation, e.g, 2.99e+008 %d integers (no decimal point shown) %s string of characters >> fprintf( 'Joe is %d weighs %f kilos', age, weight ) >> fprintf( 'Joe weighs %f kilos', n1 ) 7 fprintf to format the output
- 8. fprintf to format the output … Examples >> age = 35; >> weight = 75.25; >> fprintf( 'Joe is %d weighs %f kilosn', age, weight ) Joe is 35 weighs 75.250000 kilos >> fprintf( 'Joe weighs %4.4f kilosn', weight ) Joe weighs 75.2500 kilos >> fprintf( 'Joe weighs %4.2f kilosn', weight ) Joe weighs 75.25 kilos 8
- 9. fprintf to format the output… To display a percent sign, use %% in the text To display a single quote, use ' ' in the text (two sequential single quotes) To display a backslash, use in the text (two sequential backslashes) 9